PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF114300010CFD_t1
Common NameTRAES_3BF114300010CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 397aa    MW: 42067.1 Da    PI: 8.4926
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF114300010CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof47.24.8e-15115150237
                   zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCr 37 
                              +e  l+cprCdstnt f ++nn+s++qPr fC +Cr
  TRAES3BF114300010CFD_t1 115 PEPGLNCPRCDSTNTEFFFFNNHSVTQPRNFCGECR 150
                              567899*****************************8 PP

2zf-Dof115.42.5e-36212271261
                   zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                              +e  lkcprCdstntkfCy+nnysl+qPr+fC+aCrryWt+GGa+rnvPvGgg r++ ks
  TRAES3BF114300010CFD_t1 212 PEPGLKCPRCDSTNTKFCYFNNYSLTQPRHFCRACRRYWTRGGAVRNVPVGGGYRRSAKS 271
                              56789**************************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-12108150IPR003851Zinc finger, Dof-type
PfamPF027011.3E-12119150IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-35197270IPR003851Zinc finger, Dof-type
PfamPF027015.2E-31216270IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.584216270IPR003851Zinc finger, Dof-type
PROSITE patternPS013610218254IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MGVEIKNVRE ESVQQGITSP FLVRVRQGEE SSHHRITSPE ALLRVRMELP KQVCGALQCD  60
ATENVCESSD QSSPERNVLV ASKVDDHDSI VQSGSGVLLF PAPPPSPEQA RVPQPEPGLN  120
CPRCDSTNTE FFFFNNHSVT QPRNFCGECR LGLGAALDIA DRAAGAPAAA AYVAAASGTS  180
TSTKPSTTAT ACATSAPMSM VERARLAKVP QPEPGLKCPR CDSTNTKFCY FNNYSLTQPR  240
HFCRACRRYW TRGGAVRNVP VGGGYRRSAK SKASRNVPVG GGYSCHAKRS AKSKASDGEP  300
AAATGAASSA LTAPKPDTPS CTGTAPPGLH HYSMFCTKSE SPHSNRFADN FDLASFRLGS  360
LFADGGVHHQ PVLQGMFDLG LQRGGGNCKD GASSTTT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A077RY770.0A0A077RY77_WHEAT; Uncharacterized protein
STRINGMLOC_54725.21e-163(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.15e-41OBF-binding protein 3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]